PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g081360.1
Common NameMTR_3g081360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 514aa    MW: 58327.3 Da    PI: 6.0708
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g081360.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.92e-1293135346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       W++ E++ll++a+ ++G g+W+ +a+ +g +++  qc++++++
  Medtr3g081360.1  93 DWSAGEEKLLIEAIDMYGFGNWNGVAENVG-TKSKSQCIDHYNS 135
                      6*****************************.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250249.4E-13221513IPR016827Transcriptional adaptor 2
SMARTSM002919.1E-83074IPR000433Zinc finger, ZZ-type
SuperFamilySSF578501.53E-143497No hitNo description
CDDcd023352.84E-243482No hitNo description
PfamPF005698.8E-83473IPR000433Zinc finger, ZZ-type
PROSITE profilePS501359.9243477IPR000433Zinc finger, ZZ-type
PROSITE patternPS0135703663IPR000433Zinc finger, ZZ-type
SuperFamilySSF466892.39E-1286140IPR009057Homeodomain-like
PROSITE profilePS5129319.61189141IPR017884SANT domain
SMARTSM007171.1E-1090139IPR001005SANT/Myb domain
PfamPF002491.1E-1293135IPR001005SANT/Myb domain
CDDcd001672.22E-1094136No hitNo description
Gene3DG3DSA:1.10.10.601.8E-894136IPR009057Homeodomain-like
PROSITE profilePS5093411.699427513IPR007526SWIRM domain
SuperFamilySSF466891.18E-17429512IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0016573Biological Processhistone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MVFLSKRKKV ALNADDLEAS YAGMGITDGK VSLYHCNYCK KNISGKIHIK CAVCQDFDLC  60
IECFFVGAEL TPHKSNHPYR VMDSLSFPLT SPDWSAGEEK LLIEAIDMYG FGNWNGVAEN  120
VGTKSKSQCI DHYNSVYLNS PCFPLPDLSY SMGKNKEELL AMAKGHQLKK GLLLDDRNHN  180
FSEESKKAET TNQNMSRPTS ARDEALPSIT KKASNVNQNN DGVKVEESQA GWSAGEKKPK  240
LSGEYKPSME VLRGYNSNRG EFEIEYDNDA EQVLAEMEFK DTDTEAEREM KLQVLRGYGK  300
KLNERKRRKE FILERNLLCP DPFEKFLSPE ELQICEQYKV FMRFHSKEEH EELLQTAIRE  360
HRLAKRIKDL KEARIAGCVT SDEAYQFIEQ KRTKEAEQGN CKESGQIGTS GKTESFPSTK  420
DAPPAIQAIT KTLEEWDISD FEGAELLSES EIKLCNEIRM LPPIFLNITR IMQLEISKGR  480
VTKKSDAYPL FKFSPSKIDR IYDMLVEKGV VQA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1304309RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU0248803e-75CU024880.19 M.truncatula DNA sequence from clone MTH2-7H19 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013461144.10.0transcriptional adapter ADA2a
SwissprotQ9ATB41e-171TAD2B_ARATH; Transcriptional adapter ADA2b
SwissprotQ75LL61e-170TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLA0A072V1B90.0A0A072V1B9_MEDTR; Transcriptional adapter ADA2a
STRINGGLYMA13G11200.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]